SCOPe 2.06: Domain d1qyab1: 1qya B:2-129

Lineage for d1qyab1 (1qya B:2-129)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Hypothetical protein YddE [89864] (1 species)

7. Species Escherichia coli [TaxId:562] [89865] (4 PDB entries)
   Uniprot P37757
   structural genomics; NESG target ET25

8. Domain d1qyab1: 1qya B:2-129 [104655]
   Other proteins in same PDB: d1qyaa3, d1qyab3
   Structural genomics target

Details for d1qyab1

PDB Entry: 1qya, 2 Å

PDB Description: crystal structure of e. coli protein ydde

PDB Compounds: (B:) Hypothetical protein yddE

SCOPe Domain Sequences for d1qyab1:

Sequence; same for both SEQRES and ATOM records:

>d1qyab1 d.21.1.2 (B:2-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
kpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvrir
yftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqg
tpgfeppl

Timeline for d1qyab1:

• d1qyab1 first appeared in SCOP 1.69
  
• d1qyab1 appears in SCOPe 2.05
  
• d1qyab1 appears in SCOPe 2.07
  
• d1qyab1 appears in the current release, SCOPe 2.08