Lineage for d1qyab1 (1qya B:1-129)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501666Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 501667Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 501675Family d.21.1.2: PhzC/PhzF-like [89863] (3 proteins)
  6. 501686Protein Hypothetical protein YddE [89864] (1 species)
  7. 501687Species Escherichia coli [TaxId:562] [89865] (3 PDB entries)
    structural genomics; NESG target ET25
  8. 501698Domain d1qyab1: 1qya B:1-129 [104655]

Details for d1qyab1

PDB Entry: 1qya (more details), 2 Å

PDB Description: crystal structure of e. coli protein ydde

SCOP Domain Sequences for d1qyab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyab1 d.21.1.2 (B:1-129) Hypothetical protein YddE {Escherichia coli}
lkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
gtpgfeppl

SCOP Domain Coordinates for d1qyab1:

Click to download the PDB-style file with coordinates for d1qyab1.
(The format of our PDB-style files is described here.)

Timeline for d1qyab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qyab2