SCOP 1.75: Domain d1qyaa2: 1qya A:130-297

Lineage for d1qyaa2 (1qya A:130-297)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (4 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Hypothetical protein YddE [89864] (1 species)

7. Species Escherichia coli [TaxId:562] [89865] (3 PDB entries)
   Uniprot P37757
   structural genomics; NESG target ET25

8. Domain d1qyaa2: 1qya A:130-297 [104654]
   Structural genomics target

Details for d1qyaa2

PDB Entry: 1qya, 2 Å

PDB Description: crystal structure of e. coli protein ydde

PDB Compounds: (A:) Hypothetical protein yddE

SCOP Domain Sequences for d1qyaa2:

Sequence; same for both SEQRES and ATOM records:

>d1qyaa2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
egetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaisk
kigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvl
rvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel

Timeline for d1qyaa2:

• d1qyaa2 first appeared in SCOP 1.69
  
• d1qyaa2 appears in SCOP 1.73
  
• d1qyaa2 appears in SCOPe 2.01
  
• d1qyaa2 appears in the current release, SCOPe 2.08