Lineage for d1qyaa1 (1qya A:2-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939601Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 2939612Protein Hypothetical protein YddE [89864] (1 species)
  7. 2939613Species Escherichia coli [TaxId:562] [89865] (4 PDB entries)
    Uniprot P37757
    structural genomics; NESG target ET25
  8. 2939622Domain d1qyaa1: 1qya A:2-129 [104653]
    Other proteins in same PDB: d1qyaa3, d1qyab3
    Structural genomics target

Details for d1qyaa1

PDB Entry: 1qya (more details), 2 Å

PDB Description: crystal structure of e. coli protein ydde
PDB Compounds: (A:) Hypothetical protein yddE

SCOPe Domain Sequences for d1qyaa1:

Sequence, based on SEQRES records: (download)

>d1qyaa1 d.21.1.2 (A:2-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
kpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvrir
yftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqg
tpgfeppl

Sequence, based on observed residues (ATOM records): (download)

>d1qyaa1 d.21.1.2 (A:2-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
kpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvrir
yftptvevpihatvaahyvrakvlglgnctiwqtslkhrvtiekhnddyrisleqgtpgf
eppl

SCOPe Domain Coordinates for d1qyaa1:

Click to download the PDB-style file with coordinates for d1qyaa1.
(The format of our PDB-style files is described here.)

Timeline for d1qyaa1: