![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
![]() | Protein Hypothetical protein YddE [89864] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89865] (4 PDB entries) Uniprot P37757 structural genomics; NESG target ET25 |
![]() | Domain d1qy9d1: 1qy9 D:1-129 [104651] Structural genomics target complexed with gol, oh |
PDB Entry: 1qy9 (more details), 2.05 Å
SCOPe Domain Sequences for d1qy9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qy9d1 d.21.1.2 (D:1-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq gtpgfeppl
Timeline for d1qy9d1: