SCOPe 2.08: Domain d1qy9d1: 1qy9 D:1-129

Lineage for d1qy9d1 (1qy9 D:1-129)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Hypothetical protein YddE [89864] (1 species)

7. Species Escherichia coli [TaxId:562] [89865] (4 PDB entries)
   Uniprot P37757
   structural genomics; NESG target ET25

8. Domain d1qy9d1: 1qy9 D:1-129 [104651]
   Structural genomics target
   complexed with gol, oh

Details for d1qy9d1

PDB Entry: 1qy9, 2.05 Å

PDB Description: Crystal structure of E. coli Se-MET protein YDDE

PDB Compounds: (D:) Hypothetical protein yddE

SCOPe Domain Sequences for d1qy9d1:

Sequence; same for both SEQRES and ATOM records:

>d1qy9d1 d.21.1.2 (D:1-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvri
ryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleq
gtpgfeppl

Timeline for d1qy9d1:

• d1qy9d1 first appeared in SCOP 1.69
  
• d1qy9d1 appears in SCOPe 2.07