Lineage for d1qy9a2 (1qy9 A:130-297)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546660Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 2546671Protein Hypothetical protein YddE [89864] (1 species)
  7. 2546672Species Escherichia coli [TaxId:562] [89865] (4 PDB entries)
    Uniprot P37757
    structural genomics; NESG target ET25
  8. 2546674Domain d1qy9a2: 1qy9 A:130-297 [104646]
    Structural genomics target
    complexed with gol, oh

Details for d1qy9a2

PDB Entry: 1qy9 (more details), 2.05 Å

PDB Description: Crystal structure of E. coli Se-MET protein YDDE
PDB Compounds: (A:) Hypothetical protein yddE

SCOPe Domain Sequences for d1qy9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qy9a2 d.21.1.2 (A:130-297) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
egetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaisk
kigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvl
rvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel

SCOPe Domain Coordinates for d1qy9a2:

Click to download the PDB-style file with coordinates for d1qy9a2.
(The format of our PDB-style files is described here.)

Timeline for d1qy9a2: