Lineage for d1qx8a_ (1qx8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995435Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 1995436Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 1995437Protein ROP protein [47382] (1 species)
  7. 1995438Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 1995466Domain d1qx8a_: 1qx8 A: [104641]
    5-residue deletion mutant; tetramer
    mutant

Details for d1qx8a_

PDB Entry: 1qx8 (more details), 2.02 Å

PDB Description: Crystal structure of a five-residue deletion mutant of the Rop protein
PDB Compounds: (A:) Regulatory protein rop

SCOPe Domain Sequences for d1qx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx8a_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
ektalnmarfirsqtltlleklneladiceslhdhadelyrsclarf

SCOPe Domain Coordinates for d1qx8a_:

Click to download the PDB-style file with coordinates for d1qx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qx8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qx8b_