Lineage for d1qx8a_ (1qx8 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442133Fold a.30: ROP-like [47379] (5 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 442134Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 442135Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 442136Protein ROP protein [47382] (1 species)
  7. 442137Species Escherichia coli [TaxId:562] [47383] (10 PDB entries)
  8. 442151Domain d1qx8a_: 1qx8 A: [104641]

Details for d1qx8a_

PDB Entry: 1qx8 (more details), 2.02 Å

PDB Description: Crystal structure of a five-residue deletion mutant of the Rop protein

SCOP Domain Sequences for d1qx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx8a_ a.30.1.1 (A:) ROP protein {Escherichia coli}
ektalnmarfirsqtltlleklneladiceslhdhadelyrsclarf

SCOP Domain Coordinates for d1qx8a_:

Click to download the PDB-style file with coordinates for d1qx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qx8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qx8b_