Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species Rat (Rattus rattus) [TaxId:10117] [47519] (5 PDB entries) Uniprot P62161 |
Domain d1qx7a_: 1qx7 A: [104636] apocalmodulin; oligomer with swapped EF-hand units |
PDB Entry: 1qx7 (more details), 3.09 Å
SCOPe Domain Sequences for d1qx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qx7a_ a.39.1.5 (A:) Calmodulin {Rat (Rattus rattus) [TaxId: 10117]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmt
Timeline for d1qx7a_:
View in 3D Domains from other chains: (mouse over for more information) d1qx7b_, d1qx7i_, d1qx7m_, d1qx7r_ |