![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (10 species) |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [47519] (5 PDB entries) |
![]() | Domain d1qx5y_: 1qx5 Y: [104635] apocalmodulin; oligomer with swapped EF-hand units |
PDB Entry: 1qx5 (more details), 2.54 Å
SCOP Domain Sequences for d1qx5y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qx5y_ a.39.1.5 (Y:) Calmodulin {Rat (Rattus rattus)} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmt
Timeline for d1qx5y_: