![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (19 PDB entries) |
![]() | Domain d1qx5i_: 1qx5 I: [104630] apocalmodulin; oligomer with swapped EF-hand units |
PDB Entry: 1qx5 (more details), 2.54 Å
SCOPe Domain Sequences for d1qx5i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qx5i_ a.39.1.5 (I:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmt
Timeline for d1qx5i_: