SCOPe 2.08: Domain d1qx4b2: 1qx4 B:154-300

Lineage for d1qx4b2 (1qx4 B:154-300)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein cytochrome b5 reductase [52357] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries)
   Uniprot P20070 33-300

8. Domain d1qx4b2: 1qx4 B:154-300 [104627]
   Other proteins in same PDB: d1qx4a1, d1qx4a3, d1qx4b1, d1qx4b3
   complexed with fad; mutant

Details for d1qx4b2

PDB Entry: 1qx4, 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase

PDB Compounds: (B:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1qx4b2:

Sequence; same for both SEQRES and ATOM records:

>d1qx4b2 c.25.1.1 (B:154-300) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek
dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc
gpppmiqfaclpnlervghpkercftf

Timeline for d1qx4b2:

• d1qx4b2 first appeared in SCOP 1.69
  
• d1qx4b2 appears in SCOPe 2.07