Lineage for d1qx4b2 (1qx4 B:154-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859733Protein cytochrome b5 reductase [52357] (3 species)
  7. 2859736Species Norway rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries)
    Uniprot P20070 33-300
  8. 2859738Domain d1qx4b2: 1qx4 B:154-300 [104627]
    Other proteins in same PDB: d1qx4a1, d1qx4a3, d1qx4b1, d1qx4b3
    complexed with fad; mutant

Details for d1qx4b2

PDB Entry: 1qx4 (more details), 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase
PDB Compounds: (B:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1qx4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx4b2 c.25.1.1 (B:154-300) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek
dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc
gpppmiqfaclpnlervghpkercftf

SCOPe Domain Coordinates for d1qx4b2:

Click to download the PDB-style file with coordinates for d1qx4b2.
(The format of our PDB-style files is described here.)

Timeline for d1qx4b2: