Lineage for d1qx4b1 (1qx4 B:33-153)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403099Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2403104Protein cytochrome b5 reductase [50427] (3 species)
  7. 2403107Species Norway rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)
    Uniprot P20070 33-300
  8. 2403109Domain d1qx4b1: 1qx4 B:33-153 [104626]
    Other proteins in same PDB: d1qx4a2, d1qx4a3, d1qx4b2, d1qx4b3
    complexed with fad; mutant

Details for d1qx4b1

PDB Entry: 1qx4 (more details), 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase
PDB Compounds: (B:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1qx4b1:

Sequence, based on SEQRES records: (download)

>d1qx4b1 b.43.4.2 (B:33-153) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkethpkfpaggkmpqylenmnigdtiefrgpngllvyqg
k

Sequence, based on observed residues (ATOM records): (download)

>d1qx4b1 b.43.4.2 (B:33-153) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkeaggkmpqylenmnigdtiefrgpngllvyqgk

SCOPe Domain Coordinates for d1qx4b1:

Click to download the PDB-style file with coordinates for d1qx4b1.
(The format of our PDB-style files is described here.)

Timeline for d1qx4b1: