Lineage for d1qx4a2 (1qx4 A:154-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693238Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 693239Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 693240Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 693241Protein cytochrome b5 reductase [52357] (3 species)
  7. 693246Species Rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries)
  8. 693247Domain d1qx4a2: 1qx4 A:154-300 [104625]
    Other proteins in same PDB: d1qx4a1, d1qx4b1

Details for d1qx4a2

PDB Entry: 1qx4 (more details), 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOP Domain Sequences for d1qx4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx4a2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Rat (Rattus norvegicus) [TaxId: 10116]}
gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek
dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc
gpppmiqfaclpnlervghpkercftf

SCOP Domain Coordinates for d1qx4a2:

Click to download the PDB-style file with coordinates for d1qx4a2.
(The format of our PDB-style files is described here.)

Timeline for d1qx4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qx4a1