Lineage for d1qx2b_ (1qx2 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442525Family a.39.1.1: Calbindin D9K [47474] (1 protein)
    made of two EF-hands only
  6. 442526Protein Calbindin D9K [47475] (2 species)
  7. 442527Species Cow (Bos taurus) [TaxId:9913] [47476] (18 PDB entries)
  8. 442529Domain d1qx2b_: 1qx2 B: [104623]
    calbindomodulin; re-engineered to undergo a conformational opening

Details for d1qx2b_

PDB Entry: 1qx2 (more details), 1.44 Å

PDB Description: x-ray structure of calcium-loaded calbindomodulin (a calbindin d9k re- engineered to undergo a conformational opening) at 1.44 a resolution

SCOP Domain Sequences for d1qx2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx2b_ a.39.1.1 (B:) Calbindin D9K {Cow (Bos taurus)}
mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
evsfeeflvmmkkis

SCOP Domain Coordinates for d1qx2b_:

Click to download the PDB-style file with coordinates for d1qx2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qx2b_: