SCOPe 2.08: Domain d1qx2b_: 1qx2 B:

Lineage for d1qx2b_ (1qx2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
   Uniprot P02633

8. Domain d1qx2b_: 1qx2 B: [104623]
   calbindomodulin; re-engineered to undergo a conformational opening
   complexed with ca, zn

Details for d1qx2b_

PDB Entry: 1qx2, 1.44 Å

PDB Description: x-ray structure of calcium-loaded calbindomodulin (a calbindin d9k re- engineered to undergo a conformational opening) at 1.44 a resolution

PDB Compounds: (B:) vitamin d-dependent calcium-binding protein, intestinal

SCOPe Domain Sequences for d1qx2b_:

Sequence; same for both SEQRES and ATOM records:

>d1qx2b_ a.39.1.1 (B:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
evsfeeflvmmkkis

Timeline for d1qx2b_:

• d1qx2b_ first appeared in SCOP 1.69
  
• d1qx2b_ appears in SCOPe 2.07