Lineage for d1qx2b_ (1qx2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994321Family a.39.1.1: Calbindin D9K [47474] (2 protein domains)
    made of two EF-hands only
  6. 1994322Protein Calbindin D9K [47475] (2 species)
  7. 1994323Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
    Uniprot P02633
  8. 1994325Domain d1qx2b_: 1qx2 B: [104623]
    calbindomodulin; re-engineered to undergo a conformational opening
    complexed with ca, zn

Details for d1qx2b_

PDB Entry: 1qx2 (more details), 1.44 Å

PDB Description: X-ray Structure of Calcium-loaded Calbindomodulin (A Calbindin D9k Re-engineered to Undergo a Conformational Opening) at 1.44 A Resolution
PDB Compounds: (B:) vitamin d-dependent calcium-binding protein, intestinal

SCOPe Domain Sequences for d1qx2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qx2b_ a.39.1.1 (B:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
mkspeeikgafevfaakegdpnqiskeelklvmqtlgpsllkgmstldemieevdkngdg
evsfeeflvmmkkis

SCOPe Domain Coordinates for d1qx2b_:

Click to download the PDB-style file with coordinates for d1qx2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qx2b_: