Lineage for d1qwoa_ (1qwo A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1377357Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1377358Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1377510Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)
  6. 1377515Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 1377518Species Aspergillus fumigatus [TaxId:5085] [110657] (5 PDB entries)
    Uniprot O00092 30-464 ! Uniprot O00092
  8. 1377519Domain d1qwoa_: 1qwo A: [104620]
    complexed with nag

Details for d1qwoa_

PDB Entry: 1qwo (more details), 1.5 Å

PDB Description: crystal structure of a phosphorylated phytase from aspergillus fumigatus, revealing the structural basis for its heat resilience and catalytic pathway
PDB Compounds: (A:) phytase

SCOPe Domain Sequences for d1qwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]}
cdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryptss
kskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqrykal
arsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnntld
hgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdtvar
tsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarltrsp
vqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsvesake
ldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklndfvk
glswarsggnwgecf

SCOPe Domain Coordinates for d1qwoa_:

Click to download the PDB-style file with coordinates for d1qwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qwoa_: