Lineage for d1qwhb_ (1qwh B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457207Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 457208Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 457209Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 457230Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)
  8. 457236Domain d1qwhb_: 1qwh B: [104619]

Details for d1qwhb_

PDB Entry: 1qwh (more details), 1.36 Å

PDB Description: a covalent dimer of transthyretin that affects the amyloid pathway

SCOP Domain Sequences for d1qwhb_:

Sequence, based on SEQRES records: (download)

>d1qwhb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records): (download)

>d1qwhb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglttefvegiykve
idtksywkalgispfhehaevvftanrytiaallspysysttavvt

SCOP Domain Coordinates for d1qwhb_:

Click to download the PDB-style file with coordinates for d1qwhb_.
(The format of our PDB-style files is described here.)

Timeline for d1qwhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qwha_