SCOPe 2.06: Domain d1qvue1: 1qvu E:2-72

Lineage for d1qvue1 (1qvu E:2-72)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d1qvue1: 1qvu E:2-72 [104616]
   Other proteins in same PDB: d1qvua2, d1qvub2, d1qvud2, d1qvue2
   complexed with et, prl

Details for d1qvue1

PDB Entry: 1qvu, 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine

PDB Compounds: (E:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvue1:

Sequence; same for both SEQRES and ATOM records:

>d1qvue1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqikc

Timeline for d1qvue1:

• d1qvue1 first appeared in SCOP 1.69
  
• d1qvue1 appears in SCOPe 2.05
  
• d1qvue1 appears in SCOPe 2.07
  
• d1qvue1 appears in the current release, SCOPe 2.08