SCOP 1.71: Domain d1qvue1: 1qvu E:2-72

Lineage for d1qvue1 (1qvu E:2-72)

Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (13 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (11 PDB entries)
Domain d1qvue1: 1qvu E:2-72 [104616]
Other proteins in same PDB: d1qvua2, d1qvub2, d1qvud2, d1qvue2
complexed with et, pf

Details for d1qvue1

PDB Entry: 1qvu (more details), 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine

SCOP Domain Sequences for d1qvue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvue1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqikc

SCOP Domain Coordinates for d1qvue1:

Click to download the PDB-style file with coordinates for d1qvue1.
(The format of our PDB-style files is described here.)

Timeline for d1qvue1: