Lineage for d1qvud1 (1qvu D:2-72)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. Protein Multidrug binding protein QacR [68964] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. Domain d1qvud1: 1qvu D:2-72 [104614]
    Other proteins in same PDB: d1qvua2, d1qvub2, d1qvud2, d1qvue2
    complexed with et, prl

Details for d1qvud1

PDB Entry: 1qvu (more details), 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine
PDB Compounds: (D:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvud1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqikc

SCOPe Domain Coordinates for d1qvud1 are not available.

Timeline for d1qvud1:

Domains from same chain:
(mouse over for more information)
d1qvud2
Domains from other chains:
(mouse over for more information)
d1qvua1, d1qvua2, d1qvub1, d1qvub2, d1qvue1, d1qvue2