SCOP 1.71: Domain d1qvub2: 1qvu B:73-187

Lineage for d1qvub2 (1qvu B:73-187)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)

8. Domain d1qvub2: 1qvu B:73-187 [104613]
   Other proteins in same PDB: d1qvua1, d1qvub1, d1qvud1, d1qvue1

Details for d1qvub2

PDB Entry: 1qvu, 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine

SCOP Domain Sequences for d1qvub2:

Sequence; same for both SEQRES and ATOM records:

>d1qvub2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1qvub2:

• d1qvub2 first appeared in SCOP 1.69
  
• d1qvub2 appears in SCOP 1.73
  
• d1qvub2 appears in the current release, SCOPe 2.08