SCOP 1.71: Domain d1qvub1: 1qvu B:2-72

Lineage for d1qvub1 (1qvu B:2-72)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (11 PDB entries)

8. Domain d1qvub1: 1qvu B:2-72 [104612]
   Other proteins in same PDB: d1qvua2, d1qvub2, d1qvud2, d1qvue2

Details for d1qvub1

PDB Entry: 1qvu, 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine

SCOP Domain Sequences for d1qvub1:

Sequence; same for both SEQRES and ATOM records:

>d1qvub1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqikc

Timeline for d1qvub1:

• d1qvub1 first appeared in SCOP 1.69
  
• d1qvub1 appears in SCOP 1.73
  
• d1qvub1 appears in the current release, SCOPe 2.08