Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (11 PDB entries) |
Domain d1qvub1: 1qvu B:2-72 [104612] Other proteins in same PDB: d1qvua2, d1qvub2, d1qvud2, d1qvue2 |
PDB Entry: 1qvu (more details), 2.96 Å
SCOP Domain Sequences for d1qvub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvub1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqikc
Timeline for d1qvub1: