Lineage for d1qvua2 (1qvu A:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008196Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2008197Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2008256Domain d1qvua2: 1qvu A:73-187 [104611]
    Other proteins in same PDB: d1qvua1, d1qvub1, d1qvud1, d1qvue1
    complexed with et, prl

Details for d1qvua2

PDB Entry: 1qvu (more details), 2.96 Å

PDB Description: Crystal structure of the multidrug binding transcriptional repressor QacR bound to two drugs: ethidium and proflavine
PDB Compounds: (A:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvua2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d1qvua2:

Click to download the PDB-style file with coordinates for d1qvua2.
(The format of our PDB-style files is described here.)

Timeline for d1qvua2: