Lineage for d1qvtd2 (1qvt D:73-187)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447981Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 447982Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 447983Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 protein domains)
  6. 448007Protein Multidrug binding protein QacR [69107] (1 species)
  7. 448008Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)
  8. 448027Domain d1qvtd2: 1qvt D:73-187 [104607]
    Other proteins in same PDB: d1qvta1, d1qvtb1, d1qvtd1, d1qvte1

Details for d1qvtd2

PDB Entry: 1qvt (more details), 2.89 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine

SCOP Domain Sequences for d1qvtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvtd2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1qvtd2:

Click to download the PDB-style file with coordinates for d1qvtd2.
(The format of our PDB-style files is described here.)

Timeline for d1qvtd2: