| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Multidrug binding protein QacR [68964] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
| Domain d1qvtd1: 1qvt D:2-72 [104606] Other proteins in same PDB: d1qvta2, d1qvtb2, d1qvtd2, d1qvte2 complexed with prl, so4 |
PDB Entry: 1qvt (more details), 2.89 Å
SCOPe Domain Sequences for d1qvtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvtd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqikc
Timeline for d1qvtd1: