Lineage for d1qvtb2 (1qvt B:73-187)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543325Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 543326Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 543327Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 543353Protein Multidrug binding protein QacR [69107] (1 species)
  7. 543354Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)
  8. 543372Domain d1qvtb2: 1qvt B:73-187 [104605]
    Other proteins in same PDB: d1qvta1, d1qvtb1, d1qvtd1, d1qvte1

Details for d1qvtb2

PDB Entry: 1qvt (more details), 2.89 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine

SCOP Domain Sequences for d1qvtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvtb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1qvtb2:

Click to download the PDB-style file with coordinates for d1qvtb2.
(The format of our PDB-style files is described here.)

Timeline for d1qvtb2: