Lineage for d1qvod1 (1qvo D:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654643Domain d1qvod1: 1qvo D:182-275 [104599]
    Other proteins in same PDB: d1qvoa2, d1qvob_, d1qvod2, d1qvoe_

Details for d1qvod1

PDB Entry: 1qvo (more details), 2.22 Å

PDB Description: structures of hla-a*1101 in complex with immunodominant nonamer and decamer hiv-1 epitopes clearly reveal the presence of a middle anchor residue
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-11 alpha chain

SCOP Domain Sequences for d1qvod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvod1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1qvod1:

Click to download the PDB-style file with coordinates for d1qvod1.
(The format of our PDB-style files is described here.)

Timeline for d1qvod1: