| Class b: All beta proteins [48724] (144 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries) |
| Domain d1qvoa1: 1qvo A:182-275 [104596] Other proteins in same PDB: d1qvoa2, d1qvob_, d1qvod2, d1qvoe_ |
PDB Entry: 1qvo (more details), 2.22 Å
SCOP Domain Sequences for d1qvoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvoa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwe
Timeline for d1qvoa1:
View in 3DDomains from other chains: (mouse over for more information) d1qvob_, d1qvod1, d1qvod2, d1qvoe_ |