Lineage for d1qveb1 (1qve B:29-149)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509474Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 2509479Protein Pilin P1 [109619] (1 species)
  7. 2509480Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)
    Uniprot P17838 36-147
  8. 2509482Domain d1qveb1: 1qve B:29-149 [104595]
    Other proteins in same PDB: d1qvea2, d1qveb2

Details for d1qveb1

PDB Entry: 1qve (more details), 1.54 Å

PDB Description: Crystal structure of the truncated K122-4 pilin from Pseudomonas aeruginosa
PDB Compounds: (B:) fimbrial protein

SCOPe Domain Sequences for d1qveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qveb1 d.24.1.1 (B:29-149) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}
araqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttggtaa
asggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqtattt
t

SCOPe Domain Coordinates for d1qveb1:

Click to download the PDB-style file with coordinates for d1qveb1.
(The format of our PDB-style files is described here.)

Timeline for d1qveb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qveb2