SCOP 1.71: Domain d1q9jb2: 1q9j B:181-418

Lineage for d1q9jb2 (1q9j B:181-418)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins)
   Pfam 00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Polyketide synthase associated protein 5, PapA5 [110593] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110594] (1 PDB entry)

8. Domain d1q9jb2: 1q9j B:181-418 [104593]

Details for d1q9jb2

PDB Entry: 1q9j, 2.75 Å

PDB Description: structure of polyketide synthase associated protein 5 from mycobacterium tuberculosis

SCOP Domain Sequences for d1q9jb2:

Sequence; same for both SEQRES and ATOM records:

>d1q9jb2 c.43.1.2 (B:181-418) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis}
aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav
vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi
vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle
iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseyg

Timeline for d1q9jb2:

• d1q9jb2 first appeared in SCOP 1.69
  
• d1q9jb2 appears in SCOP 1.73
  
• d1q9jb2 appears in the current release, SCOPe 2.08