SCOPe 2.05: Domain d1q9jb1: 1q9j B:3-175

Lineage for d1q9jb1 (1q9j B:3-175)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins)
   Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Polyketide synthase associated protein 5, PapA5 [110593] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110594] (1 PDB entry)
   Uniprot P96208

8. Domain d1q9jb1: 1q9j B:3-175 [104592]

Details for d1q9jb1

PDB Entry: 1q9j, 2.75 Å

PDB Description: structure of polyketide synthase associated protein 5 from mycobacterium tuberculosis

PDB Compounds: (B:) Polyketide synthase associated protein 5

SCOPe Domain Sequences for d1q9jb1:

Sequence, based on SEQRES records:

>d1q9jb1 c.43.1.2 (B:3-175) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis [TaxId: 1773]}
pgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqssd
ggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltlyl
hhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirk

Sequence, based on observed residues (ATOM records):

>d1q9jb1 c.43.1.2 (B:3-175) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis [TaxId: 1773]}
pgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqssd
ggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhgav
lvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirk

Timeline for d1q9jb1:

• d1q9jb1 first appeared in SCOP 1.69
  
• d1q9jb1 appears in SCOPe 2.04
  
• d1q9jb1 appears in SCOPe 2.06
  
• d1q9jb1 appears in the current release, SCOPe 2.08