Lineage for d1q9ga_ (1q9g A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627487Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2627488Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
    automatically mapped to Pfam PF13505
  6. 2627499Protein Outer membrane protein X (OMPX) [56929] (1 species)
  7. 2627500Species Escherichia coli [TaxId:562] [56930] (8 PDB entries)
    Uniprot P36546
  8. 2627507Domain d1q9ga_: 1q9g A: [104589]

Details for d1q9ga_

PDB Entry: 1q9g (more details)

PDB Description: nmr structure of the outer membrane protein ompx in dhpc micelles
PDB Compounds: (A:) Outer membrane protein X

SCOPe Domain Sequences for d1q9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ga_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]}
atstvtggyaqsdaqgqmnkmggfnlkyryeednsplgvigsftyteksrtassgdynkn
qyygitagpayrindwasiygvvgvgygkfqtteyptykndtsdygfsygaglqfnpmen
valdfsyeqsrirsvdvgtwiagvgyrf

SCOPe Domain Coordinates for d1q9ga_:

Click to download the PDB-style file with coordinates for d1q9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ga_: