Lineage for d1q95k1 (1q95 K:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723615Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 723616Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 723617Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 723621Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)
  8. 723654Domain d1q95k1: 1q95 K:1-100 [104585]
    Other proteins in same PDB: d1q95a1, d1q95a2, d1q95b1, d1q95b2, d1q95c1, d1q95c2, d1q95d1, d1q95d2, d1q95e1, d1q95e2, d1q95f1, d1q95f2, d1q95g2, d1q95h2, d1q95i2, d1q95j2, d1q95k2, d1q95l2

Details for d1q95k1

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (K:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1q95k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95k1 d.58.2.1 (K:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1q95k1:

Click to download the PDB-style file with coordinates for d1q95k1.
(The format of our PDB-style files is described here.)

Timeline for d1q95k1: