Lineage for d1q95g2 (1q95 G:101-153)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524338Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 524339Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 524340Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 524343Species Escherichia coli [TaxId:562] [57828] (33 PDB entries)
  8. 524360Domain d1q95g2: 1q95 G:101-153 [104578]
    Other proteins in same PDB: d1q95a1, d1q95a2, d1q95b1, d1q95b2, d1q95c1, d1q95c2, d1q95d1, d1q95d2, d1q95e1, d1q95e2, d1q95f1, d1q95f2, d1q95g1, d1q95h1, d1q95i1, d1q95j1, d1q95k1, d1q95l1

Details for d1q95g2

PDB Entry: 1q95 (more details), 2.46 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate

SCOP Domain Sequences for d1q95g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q95g2 g.41.7.1 (G:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1q95g2:

Click to download the PDB-style file with coordinates for d1q95g2.
(The format of our PDB-style files is described here.)

Timeline for d1q95g2: