Lineage for d1q8xa_ (1q8x A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509538Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 509606Family d.109.1.2: Cofilin-like [55762] (7 proteins)
  6. 509616Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 509625Species Human (Homo sapiens), non-muscle isoform [TaxId:9606] [111104] (2 PDB entries)
  8. 509627Domain d1q8xa_: 1q8x A: [104558]

Details for d1q8xa_

PDB Entry: 1q8x (more details)

PDB Description: nmr structure of human cofilin

SCOP Domain Sequences for d1q8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8xa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Human (Homo sapiens), non-muscle isoform}
masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl

SCOP Domain Coordinates for d1q8xa_:

Click to download the PDB-style file with coordinates for d1q8xa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8xa_: