![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species) |
![]() | Species Human (Homo sapiens), non-muscle isoform [TaxId:9606] [111104] (3 PDB entries) Uniprot P23528 |
![]() | Domain d1q8xa_: 1q8x A: [104558] |
PDB Entry: 1q8x (more details)
SCOPe Domain Sequences for d1q8xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8xa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Human (Homo sapiens), non-muscle isoform [TaxId: 9606]} masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl
Timeline for d1q8xa_: