Lineage for d1q8ka2 (1q8k A:186-302)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505716Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 505717Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 505718Protein eIF-2-alpha, C-terminal domain [110995] (1 species)
  7. 505719Species Human (Homo sapiens) [TaxId:9606] [110996] (1 PDB entry)
  8. 505720Domain d1q8ka2: 1q8k A:186-302 [104557]
    Other proteins in same PDB: d1q8ka1

Details for d1q8ka2

PDB Entry: 1q8k (more details)

PDB Description: solution structure of alpha subunit of human eif2

SCOP Domain Sequences for d1q8ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ka2 d.58.51.1 (A:186-302) eIF-2-alpha, C-terminal domain {Human (Homo sapiens)}
qavkiradievacygyegidavkealraglncstenmpikinliappryvmttttlerte
glsvlsqamavikekieekrgvfnvqmepkvvtdtdetelarqmerlerenaevdgd

SCOP Domain Coordinates for d1q8ka2:

Click to download the PDB-style file with coordinates for d1q8ka2.
(The format of our PDB-style files is described here.)

Timeline for d1q8ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q8ka1