Lineage for d1q8da_ (1q8d A:)
- Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds) 
Fold a.228: GDNF receptor-like (Pfam 02351) [110034] (1 superfamily)
5 helices: irregular disulfide-linked array; topological similarity to the Fungal elicitin fold (scop_cf 48646)Superfamily a.228.1: GDNF receptor-like (Pfam 02351) [110035] (1 family) 
Family a.228.1.1: GDNF receptor-like (Pfam 02351) [110036] (1 protein) Protein GDNF receptor alpha [110037] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [110038] (1 PDB entry) 
Domain d1q8da_: 1q8d A: [104554]
Details for d1q8da_
PDB Entry: 1q8d (more details), 1.8 Å
PDB Description: The crystal structure of GDNF family co-receptor alpha 1 domain 3
SCOP Domain Sequences for d1q8da_:
Sequence, based on SEQRES records: (download)
>d1q8da_ a.228.1.1 (A:) GDNF receptor alpha {Rat (Rattus norvegicus)}
erpnclslqdscktnyicrsrladfftncqpesrsvsnclkenyadcllaysgligtvmt
pnyvdssslsvapwcdcsnsgndledclkflnffkdntclknaiqafg
Sequence, based on observed residues (ATOM records): (download)
>d1q8da_ a.228.1.1 (A:) GDNF receptor alpha {Rat (Rattus norvegicus)}
erpnclslqdscktnyicrsrladfftncqpesrsvsnclkenyadcllaysgligtvmt
pnvapwcdcsnsgndledclkflnffkdntclknaiqafg
SCOP Domain Coordinates for d1q8da_:
Click to download the PDB-style file with coordinates for d1q8da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q8da_:
- d1q8da_ is new in SCOP 1.69
- d1q8da_ appears in SCOP 1.71
- d1q8da_ appears in the current release, SCOPe 2.08
View in 3D