Lineage for d1q8da_ (1q8d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015709Fold a.228: GDNF receptor-like [110034] (1 superfamily)
    5 helices: irregular disulfide-linked array; topological similarity to the Fungal elicitin fold (48646)
  4. 2015710Superfamily a.228.1: GDNF receptor-like [110035] (1 family) (S)
    automatically mapped to Pfam PF02351
  5. 2015711Family a.228.1.1: GDNF receptor-like [110036] (1 protein)
    Pfam PF02351
  6. 2015712Protein GDNF receptor alpha [110037] (1 species)
  7. 2015713Species Norway rat (Rattus norvegicus) [TaxId:10116] [110038] (1 PDB entry)
    Uniprot Q62997 239-346
  8. 2015714Domain d1q8da_: 1q8d A: [104554]
    complexed with mpd

Details for d1q8da_

PDB Entry: 1q8d (more details), 1.8 Å

PDB Description: The crystal structure of GDNF family co-receptor alpha 1 domain 3
PDB Compounds: (A:) GDNF family receptor alpha 1

SCOPe Domain Sequences for d1q8da_:

Sequence, based on SEQRES records: (download)

>d1q8da_ a.228.1.1 (A:) GDNF receptor alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
erpnclslqdscktnyicrsrladfftncqpesrsvsnclkenyadcllaysgligtvmt
pnyvdssslsvapwcdcsnsgndledclkflnffkdntclknaiqafg

Sequence, based on observed residues (ATOM records): (download)

>d1q8da_ a.228.1.1 (A:) GDNF receptor alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
erpnclslqdscktnyicrsrladfftncqpesrsvsnclkenyadcllaysgligtvmt
pnvapwcdcsnsgndledclkflnffkdntclknaiqafg

SCOPe Domain Coordinates for d1q8da_:

Click to download the PDB-style file with coordinates for d1q8da_.
(The format of our PDB-style files is described here.)

Timeline for d1q8da_: