Lineage for d1q80a_ (1q80 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995226Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. 1995229Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (2 PDB entries)
    Uniprot P04571
  8. 1995232Domain d1q80a_: 1q80 A: [104553]

Details for d1q80a_

PDB Entry: 1q80 (more details)

PDB Description: Solution structure and dynamics of Nereis sarcoplasmic calcium binding protein
PDB Compounds: (A:) Sarcoplasmic calcium-binding protein

SCOPe Domain Sequences for d1q80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q80a_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

SCOPe Domain Coordinates for d1q80a_:

Click to download the PDB-style file with coordinates for d1q80a_.
(The format of our PDB-style files is described here.)

Timeline for d1q80a_: