![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Sarcoplasmic calcium-binding protein [47509] (2 species) |
![]() | Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (2 PDB entries) Uniprot P04571 |
![]() | Domain d1q80a_: 1q80 A: [104553] |
PDB Entry: 1q80 (more details)
SCOPe Domain Sequences for d1q80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q80a_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv
Timeline for d1q80a_: