Lineage for d1q79a3 (1q79 A:365-498)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504982Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 504983Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 504984Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 504988Species Cow (Bos taurus) [TaxId:9913] [55007] (3 PDB entries)
  8. 504989Domain d1q79a3: 1q79 A:365-498 [104550]
    Other proteins in same PDB: d1q79a1, d1q79a2

Details for d1q79a3

PDB Entry: 1q79 (more details), 2.15 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

SCOP Domain Sequences for d1q79a3:

Sequence, based on SEQRES records: (download)

>d1q79a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus)}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevdmkia
amhvkrkqlhqllp

Sequence, based on observed residues (ATOM records): (download)

>d1q79a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus)}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlh
qllp

SCOP Domain Coordinates for d1q79a3:

Click to download the PDB-style file with coordinates for d1q79a3.
(The format of our PDB-style files is described here.)

Timeline for d1q79a3: