Lineage for d1q79a3 (1q79 A:365-498)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176087Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2176088Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2176089Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2176099Species Cow (Bos taurus) [TaxId:9913] [55007] (3 PDB entries)
    Uniprot P25500 18-497
  8. 2176100Domain d1q79a3: 1q79 A:365-498 [104550]
    Other proteins in same PDB: d1q79a1, d1q79a2
    complexed with 3at, gol, mn

Details for d1q79a3

PDB Entry: 1q79 (more details), 2.15 Å

PDB Description: crystal structure of mammalian poly(a) polymerase
PDB Compounds: (A:) Poly(A) polymerase alpha

SCOPe Domain Sequences for d1q79a3:

Sequence, based on SEQRES records: (download)

>d1q79a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevdmkia
amhvkrkqlhqllp

Sequence, based on observed residues (ATOM records): (download)

>d1q79a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlh
qllp

SCOPe Domain Coordinates for d1q79a3:

Click to download the PDB-style file with coordinates for d1q79a3.
(The format of our PDB-style files is described here.)

Timeline for d1q79a3: