| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) ![]() |
| Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543 |
| Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81587] (3 PDB entries) Uniprot P25500 18-497 |
| Domain d1q79a2: 1q79 A:19-214 [104549] Other proteins in same PDB: d1q79a1, d1q79a3 complexed with 3at, gol, mn |
PDB Entry: 1q79 (more details), 2.15 Å
SCOPe Domain Sequences for d1q79a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q79a2 d.218.1.3 (A:19-214) Poly(A) polymerase, PAP, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
hygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirci
rslngcrvtdeilhlv
Timeline for d1q79a2: