Lineage for d1q79a2 (1q79 A:19-214)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516107Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 516108Superfamily d.218.1: Nucleotidyltransferase [81301] (9 families) (S)
  5. 516247Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 516248Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 516252Species Cow (Bos taurus) [TaxId:9913] [81587] (3 PDB entries)
  8. 516253Domain d1q79a2: 1q79 A:19-214 [104549]
    Other proteins in same PDB: d1q79a1, d1q79a3

Details for d1q79a2

PDB Entry: 1q79 (more details), 2.15 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

SCOP Domain Sequences for d1q79a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q79a2 d.218.1.3 (A:19-214) Poly(A) polymerase, PAP, N-terminal domain {Cow (Bos taurus)}
hygitspislaapketdalltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirai
rslngcrvtdeilhlv

SCOP Domain Coordinates for d1q79a2:

Click to download the PDB-style file with coordinates for d1q79a2.
(The format of our PDB-style files is described here.)

Timeline for d1q79a2: