![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein) |
![]() | Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries) Uniprot P25500 18-497 |
![]() | Domain d1q79a1: 1q79 A:215-364 [104548] Other proteins in same PDB: d1q79a2, d1q79a3 complexed with 3at, gol, mn |
PDB Entry: 1q79 (more details), 2.15 Å
SCOP Domain Sequences for d1q79a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q79a1 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]} pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr mvmveefkqglaitdeillskaewsklfea
Timeline for d1q79a1: