Lineage for d1q79a1 (1q79 A:215-364)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650456Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 650457Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (4 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 650458Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 650459Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 650466Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries)
  8. 650467Domain d1q79a1: 1q79 A:215-364 [104548]
    Other proteins in same PDB: d1q79a2, d1q79a3
    complexed with 3at, gol, mn

Details for d1q79a1

PDB Entry: 1q79 (more details), 2.15 Å

PDB Description: crystal structure of mammalian poly(a) polymerase
PDB Compounds: (A:) Poly(A) polymerase alpha

SCOP Domain Sequences for d1q79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q79a1 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]}
pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl
vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr
mvmveefkqglaitdeillskaewsklfea

SCOP Domain Coordinates for d1q79a1:

Click to download the PDB-style file with coordinates for d1q79a1.
(The format of our PDB-style files is described here.)

Timeline for d1q79a1: