Lineage for d1q78a3 (1q78 A:365-498)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029088Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 1029089Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 1029090Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 1029100Species Cow (Bos taurus) [TaxId:9913] [55007] (3 PDB entries)
    Uniprot P25500 18-497
  8. 1029103Domain d1q78a3: 1q78 A:365-498 [104547]
    Other proteins in same PDB: d1q78a1, d1q78a2
    protein/RNA complex; complexed with 3at, mg

Details for d1q78a3

PDB Entry: 1q78 (more details), 2.8 Å

PDB Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride
PDB Compounds: (A:) Poly(A) polymerase alpha

SCOPe Domain Sequences for d1q78a3:

Sequence, based on SEQRES records: (download)

>d1q78a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevdmkia
amhvkrkqlhqllp

Sequence, based on observed residues (ATOM records): (download)

>d1q78a3 d.58.16.1 (A:365-498) Poly(A) polymerase, PAP, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlh
qllp

SCOPe Domain Coordinates for d1q78a3:

Click to download the PDB-style file with coordinates for d1q78a3.
(The format of our PDB-style files is described here.)

Timeline for d1q78a3: